SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Q5WSG1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1Q5WSG1
Domain Number - Region: 129-183
Classification Level Classification E-value
Superfamily YdhA-like 0.0327
Family YdhA-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Q5WSG1
Sequence length 233
Comment (tr|A0A1Q5WSG1|A0A1Q5WSG1_PSEFL) Metal-dependent hydrolase {ECO:0000313|EMBL:OKP68047.1} KW=Complete proteome OX=294 OS=Pseudomonas fluorescens. GN=BTR19_22305 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MSSQTLTVNDLQLTLRRSARRKTLQITVERDGALILSAPPEVEEQALRQFVAEKSFWIYS
RLAEKERLQRSIPTKEYVDGEGFLYLGRSYRLKLVDEQDGALKLSAGRFRLLRSELPRAR
EHFIRWYSEHARSWLALRVKNHQARMDLPPSGVRVQDLGYRWGSCGKGAQLYFHWKTILL
PKPIAEYVVVHEMVHLQEPHHTPEFWLRLERVMPDYAQRKTWLAEHGIDVEGI
Download sequence
Identical sequences A0A1Q5WSG1
WP_019817990.1.24311 WP_019817990.1.35520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]