SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Q7FXX7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Q7FXX7
Domain Number 1 Region: 95-161
Classification Level Classification E-value
Superfamily NosL/MerB-like 0.00000000000157
Family MerB-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1Q7FXX7
Sequence length 173
Comment (tr|A0A1Q7FXX7|A0A1Q7FXX7_9BACT) Uncharacterized protein {ECO:0000313|EMBL:OLC31708.1} KW=Complete proteome OX=1805364 OS=Candidatus Rokubacteria bacterium 13_1_40CM_4_69_5. GN=AUH81_17335 OC=Bacteria; Candidatus Rokubacteria.
Sequence
MAILEIKTADELIDQDLEARWTTRRAARQTEVFHRILRIFLDRGGAIRVEDIVAAFPDGP
AQAVHEALVALDGDDLIRIRDGQVDIAYPFSAWPTPFVARLPGAKERYACCAIDALGIAP
MVGSRVEIRSRCHHCTMPLEFSIEPDGPGHEADSVMLWLGKRTDERRRVADSL
Download sequence
Identical sequences A0A1Q7FXX7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]