SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Q9CP00 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1Q9CP00
Domain Number - Region: 120-158
Classification Level Classification E-value
Superfamily BEACH domain 0.00327
Family BEACH domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Q9CP00
Sequence length 197
Comment (tr|A0A1Q9CP00|A0A1Q9CP00_SYMMI) Uncharacterized protein {ECO:0000313|EMBL:OLP84644.1} KW=Complete proteome; Reference proteome OX=2951 OS=microadriatica). GN=AK812_SmicGene34466 OC=Symbiodinium.
Sequence
MQLCAAIGVRSVVHFPVRYKNRYGRLQLEDNAMAVSFSMGSFGAYLPYPYPTILVGTDRL
LLKGIKYVAGRMFRLMTAPADLENMPATSAGGEASGTFHFVVMDIVMLRHRHNDHRSVNW
PSVFDDLAKSHVDHDLDSWFRPLTEPAIALKKRRVMHDLFFEDEDFVVTRPVPPVAATPA
GAVLLLHSFGVSLTRLQ
Download sequence
Identical sequences A0A1Q9CP00

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]