SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1Q9DPW5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Q9DPW5
Domain Number 1 Region: 22-236
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 5.49e-44
Family Ypt/Rab-GAP domain of gyp1p 0.000026
Further Details:      
 
Domain Number 2 Region: 211-330
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.97e-39
Family Ypt/Rab-GAP domain of gyp1p 0.0000335
Further Details:      
 
Domain Number 3 Region: 361-575
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.35e-37
Family Capz beta-1 subunit 0.000028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Q9DPW5
Sequence length 579
Comment (tr|A0A1Q9DPW5|A0A1Q9DPW5_SYMMI) TBC1 domain family member 22B {ECO:0000313|EMBL:OLP97205.1} KW=Complete proteome; Reference proteome OX=2951 OS=microadriatica). GN=AK812_SmicGene20464 OC=Symbiodinium.
Sequence
MQSVSSSSASDTGRSAKAQKFYRLLSLPSVDLAALRELLWSGAPEEDPKIRAEAWQMLLG
YLPPVKDRQGPGLQKKREEYEELRRRHYTPIESGQDGLSDVDSAAILRQIRVDIPRTSPG
LPIFSHPRIHQLLERVLFIWSIRHPASGYVQGINDIATPFVVVLLASRLDCLPEDIDVDA
ATDEMLDSVEAGAYWCLTKFLSDIQDHYTAGQPGIQQMVAKLKEIVHRIDQKLYEHLESQ
GLDFLQLSFRWMNCLLLREFPFPCVIRLWDTYIAEPLEGFSSFHVYVCAVFLIYWSPQLK
QMDFQQLMLFMQKLPTGKWRNQEIETLLAEVGDSERAGPHHGHIATGKRLCFRESGLAPY
ISRPLKVKEDLKANRYFVASDYNFDGGSHRSPWTDRYIPVPPGGEAEEERLFRPSARLKR
LEQSFNEVFEAYVMSYYEGGVSSVYLWDLDEGFAGAFLVHKELAKVLGDGKTGVWDSIHV
LEVRESPNSHYVDFKLSSAIWLHFQVAAKADQTELSGHLTRQAEARLDRRKKAGEDAQII
QVGTMIEDNENFLRHNLECIHLAKQRTVLDAVRSQAAGP
Download sequence
Identical sequences A0A1Q9DPW5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]