SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Q9HRY2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Q9HRY2
Domain Number 1 Region: 1-103
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 2.27e-39
Family Frataxin-like 0.0000569
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Q9HRY2
Sequence length 104
Comment (tr|A0A1Q9HRY2|A0A1Q9HRY2_9VIBR) Iron-sulfur cluster assembly protein CyaY {ECO:0000256|HAMAP-Rule:MF_00142, ECO:0000256|SAAS:SAAS01015787} KW=Complete proteome OX=265668 OS=Vibrio ponticus. GN=BIY21_11200 OC=Vibrionaceae; Vibrio.
Sequence
MNETEFHQLADQQMQFIEEMIDDSGADIDYETSGNVMTLEFEDRSQIIINRQEPMKEIWL
ASRSGGFHFAYVEQQWICSKTGLELIAMVKQECEKHAGETIDWV
Download sequence
Identical sequences A0A1Q9HRY2
WP_075649177.1.36074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]