SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1R1PHK8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1R1PHK8
Domain Number 1 Region: 13-76
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000238
Family BTB/POZ domain 0.0012
Further Details:      
 
Domain Number 2 Region: 125-160
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.000000523
Family Skp1 dimerisation domain-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1R1PHK8
Sequence length 196
Comment (tr|A0A1R1PHK8|A0A1R1PHK8_ZANCU) E3 ubiquitin ligase complex SCF subunit sconC {ECO:0000313|EMBL:OMH80428.1} KW=Complete proteome; Reference proteome OX=1213189 OS=Zancudomyces culisetae (Gut fungus) (Smittium culisetae). GN=AX774_g6127 OC=Legeriomycetaceae; Zancudomyces.
Sequence
MEHINEQPTHINLKLQTSEGCIVLAPRNMLEKFSNTVKDVILQLPESHECEVIPLPNISA
TILNKVIAYCSHHYNSHQSSATARKCTSEPIVPKIQPSSTFQYSGAHIVNGNTSSSIGSA
ESGISFCEWDLSFTRILDQATLFDLLLAANYLDIEQLPLLSMENMRHLDRADTNMVGHSR
GHLHQYQLLADLRQMV
Download sequence
Identical sequences A0A1R1PHK8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]