SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1R1PKS1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1R1PKS1
Domain Number 1 Region: 56-278
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.24e-46
Family Capz alpha-1 subunit 0.0000598
Further Details:      
 
Domain Number 2 Region: 639-729
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000756
Family DNA-repair protein XRCC1 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1R1PKS1
Sequence length 846
Comment (tr|A0A1R1PKS1|A0A1R1PKS1_ZANCU) Nucleolar protein 7 homolog {ECO:0000256|HAMAP-Rule:MF_03028} KW=Complete proteome; Reference proteome OX=1213189 OS=Zancudomyces culisetae (Gut fungus) (Smittium culisetae). GN=AX774_g4989 OC=Legeriomycetaceae; Zancudomyces.
Sequence
MEQFYVATVDTTLSHPSTSSTAINSKTSPDRDIEESEAERERKEDENENQAGAGVETVGK
TVMLTKYNYRTETNEYYDYENKIRFEFDHLRLKAYNVQPLPDSNLVDSNASEAGKIELFR
NELLLLAETYIEEHYNGGKSLVTDFMCDKTNEHKYAVCIVSNKYSPENYWNGRWQAMWEY
SPETGSLNGHVKVLVHYYEDGNVQLAVEKKDLFEQLAPLSSISTGSDKDEVETLTLEIFE
AIQTFEKQVQLDINQNYHVLSEQTFKDLRRKLPLTKTMGKLKKAGQEGSVAKYTSRNRAL
KRLQLSLGSFRRLCILKGIYPVEPKNHQRKRVQNSTNSKSPATNTTYYYTKDVAYLQQDS
ILMQRVRDHKIFKRQLKRAVARQEWDKAKRLKELKRKEGGSGDGEGSGMLDHVILERYPR
FEDALGDLDDALSLVCLFSYDSTIPTKSGSAASNKRLVNSCRRLKLQFHNYVVHTHALRK
VFLSVKGVYYQAVIHGTTVTWLVPYNHTGNAASLSGSSNQQIIGVDFKVLWSFLELYQTL
IGFVNFKLFDELDLVATTTANTKNVAESLGLDLLGCLAIKNKPSSIALPILDSNAAPETQ
AQETATTTTTTTTATTTTTTATVDTSATATADADSHQQPLLFSNITFFLSRETPRESLEF
VIRALGGNVCTNYYINGNYNPSITDSFEEISYIVTDRPEPQSSSTNKNVIYVQPQFVYDC
VNANKLVNHTLYHPKVADLPPHLSPFVTYKPGDYIPLQHRAGSLEVEDSGETGTHYSANP
SLDNSSSAHESVLLAKPLLSKKKRKLFDRIQHGYQRRKADADKLEQSRLLADSSTLEQHG
SDSGSS
Download sequence
Identical sequences A0A1R1PKS1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]