SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1R1SB33 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1R1SB33
Domain Number 1 Region: 2-181
Classification Level Classification E-value
Superfamily BB2672-like 2.49e-60
Family BB2672-like 0.0000386
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1R1SB33
Sequence length 193
Comment (tr|A0A1R1SB33|A0A1R1SB33_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:OMI35417.1} KW=Complete proteome; Reference proteome OX=1331668 OS=Streptomyces sparsogenes DSM 40356. GN=SPAR_31321 OC=Streptomyces.
Sequence
MTVVDEVLLELGRPVATPVRRVAAAAVIRNPWAGRGFVADLQPEVEEIAPGLAHLLTGRL
VETLGGVDRIEAFGKAAMVGVDGEIEHGGALIHTPYFGNVLRELTEATSIIVFSDDRLRA
GEPLTVPLWHKTAAATRSHYQTCQIRVPDAPRPDEIVVVAAASSGPRPNARIGDRLTDPV
VRLADLDALENAR
Download sequence
Identical sequences A0A1R1SB33

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]