SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1R3XH29 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1R3XH29
Domain Number - Region: 77-132
Classification Level Classification E-value
Superfamily occludin/ELL-like 0.0183
Family Occludin/ELL domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1R3XH29
Sequence length 272
Comment (tr|A0A1R3XH29|A0A1R3XH29_9BACI) Membrane protein YidC {ECO:0000256|HAMAP-Rule:MF_01811} KW=Complete proteome OX=1855345 OS=Bacillus sp. RRD69. GN=SAMN05216491_2408 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MKRLLTICTTLFLMMVASPAFAASAQTNTSSDGFFHHYFVQPFSELIIWLANFFHDDYGL
SIMFVTLIVRLLIFPLFANQFKKQRVMQEKMALVKPQIDQIQSKLKKTKEPEKQKELQME
MMKVYKDNNVNPLAMGCLPMLIQIPIVLGFYSAIRSTPEIATHSFLWFNLGQTDLLVAIF
AGAMYFLQFYVTQKFAKQSGTQTEAALKQAKIMGMIFPVMMLFLSINAPAALPLYWMTSG
LLLTIQTIILNVMYQKSKTKAAANDSINPAAE
Download sequence
Identical sequences A0A1C4DMR8 A0A1R3XH29 A0A1V9CLG4 A0A2D1X3G6 M5RE14 W8R1C5
WP_007501121.1.101882 WP_007501121.1.11125 WP_007501121.1.15494 WP_007501121.1.16908 WP_007501121.1.21333 WP_007501121.1.30436 WP_007501121.1.43057 WP_007501121.1.44393 WP_007501121.1.45032 WP_007501121.1.59301 WP_007501121.1.77904 WP_007501121.1.8171 WP_007501121.1.85712 WP_007501121.1.8598 WP_007501121.1.86695 WP_007501121.1.86781 WP_007501121.1.95469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]