SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1R7F080 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1R7F080
Domain Number - Region: 18-56
Classification Level Classification E-value
Superfamily MukF C-terminal domain-like 0.0536
Family MukF C-terminal domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1R7F080
Sequence length 76
Comment (tr|A0A1R7F080|A0A1R7F080_CLODI) Uncharacterized protein {ECO:0000313|EMBL:SJT98531.1} KW=Complete proteome OX=1496 OS=Clostridioides difficile (Peptoclostridium difficile). GN=SAMEA3375004_03227 OC=Peptostreptococcaceae; Clostridioides.
Sequence
MKEYIIWFKSGNSISGIVDEDVADKLMQDFIEADSDCRNLKGYLDEDGTTIIDLSQIEAI
SINNCSENNNIGFNPR
Download sequence
Identical sequences A0A1R7F080
WP_021374980.1.12632 WP_021374980.1.16190 WP_021374980.1.19648 WP_021374980.1.27563 WP_021374980.1.32166 WP_021374980.1.33098 WP_021374980.1.34545 WP_021374980.1.35709 WP_021374980.1.36257 WP_021374980.1.49230 WP_021374980.1.52330 WP_021374980.1.559 WP_021374980.1.6031 WP_021374980.1.63950 WP_021374980.1.64859 WP_021374980.1.65313 WP_021374980.1.66701 WP_021374980.1.69333 WP_021374980.1.73852 WP_021374980.1.74779 WP_021374980.1.78949 WP_021374980.1.83288 WP_021374980.1.8336 WP_021374980.1.83477 WP_021374980.1.90921 WP_021374980.1.90985 WP_021374980.1.93968 WP_021374980.1.96503 WP_021374980.1.97672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]