SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S0U8N1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S0U8N1
Domain Number 1 Region: 12-188
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.38e-34
Family G proteins 0.0001
Further Details:      
 
Domain Number 2 Region: 184-223
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000275
Family SOCS box-like 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1S0U8N1
Sequence length 280
Comment (tr|A0A1S0U8N1|A0A1S0U8N1_LOALO) Ras family protein {ECO:0000313|EMBL:EFO26094.2} OX=7209 OS=Loa loa (Eye worm) (Filaria loa). GN=LOAG_02389 OC=Spiruromorpha; Filarioidea; Onchocercidae; Loa.
Sequence
MRIGASELCREEHEYMLKFLLVGDSDVGKDEIADLLGPSVSYTPDALFIPFAVPKTTTIL
LEGKFVRLQLWNASGQGRFSTIIKSYSRGVQGILLVYDITNRWSFDGIRRWLAEIDEHAP
GVPRILIGNRLHLEFNRAVPRHEAEYFARKRNMQYFEISTLAYFNVHESITELARLVISR
NGMQWLWKSSQVASLQDLCCRAVVKYISNVHAIDRLPLPTFLQLKVRSFASGADLCMHSV
IRRQYATPYFSSASKYITRFVRARNTNTKDRLRNANCDLM
Download sequence
Identical sequences A0A1S0U8N1
XP_020303610.1.37734 LOAG_02389T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]