SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1S0ZNJ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1S0ZNJ2
Domain Number - Region: 52-121
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0162
Family Capz beta-1 subunit 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1S0ZNJ2
Sequence length 212
Comment (tr|A0A1S0ZNJ2|A0A1S0ZNJ2_SALCE) Uncharacterized protein {ECO:0000313|EMBL:OHH04897.1} KW=Complete proteome OX=28901 OS=Salmonella choleraesuis. GN=A7R90_22890 OC=Enterobacteriaceae; Salmonella.
Sequence
MTTFYYKDVPNYLINSFVAVRDSFSNLENLLCVVNIINHCQVHRESNGLDFDIAILTSGI
NRILVKRNDGFFTMSFPFQLIDYGYNLSAHLDDYGITIDAAFISYMKNALETATSNVYCH
DDIALSLNNSFGLEGLDCTIYADIFSHLLLKDHGYFRFDDDPVNENARIHPRYHFDFFCT
NSSSVKLGHPNLINSDFFFDLFDVNKDRPYLT
Download sequence
Identical sequences A0A1S0ZNJ2
WP_023246872.1.13812 WP_023246872.1.18483 WP_023246872.1.22303 WP_023246872.1.23041 WP_023246872.1.33134 WP_023246872.1.38886 WP_023246872.1.4037 WP_023246872.1.45943 WP_023246872.1.48033 WP_023246872.1.6384 WP_023246872.1.65471 WP_023246872.1.71245 WP_023246872.1.71793 WP_023246872.1.82865 WP_023246872.1.92396 WP_023246872.1.9394 WP_023246872.1.99320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]