SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S1G9L7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S1G9L7
Domain Number 1 Region: 59-162
Classification Level Classification E-value
Superfamily NosL/MerB-like 3.14e-31
Family NosL-like 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1S1G9L7
Sequence length 164
Comment (tr|A0A1S1G9L7|A0A1S1G9L7_9NEIS) Copper-binding protein {ECO:0000313|EMBL:OHR78400.1} KW=Complete proteome OX=1608896 OS=Neisseria sp. HMSC70E02. GN=HMPREF3277_01365 OC=Neisseriaceae; Neisseria.
Sequence
MKKILPALLAALLLSACPKEDDTPPPEPQQISDRAVGHYCSMNLTEHNGPKAQIYLNGKP
DRPVWFSTIKQMFGYTKLPEEPKGIHVIYVTDMGKVKDWSKPNADTAWIDGKKAYYVIES
GFIGGMGAEDALPFADKAQAEKFAKEKGGRVVSFDEMPDSYIFK
Download sequence
Identical sequences A0A0C1GL17 A0A0D9LW77 A0A1F1UD73 A0A1S1G9L7 A0A1V0HDS3 C6M6C6 F9EV98 G3Z2R6 I2NHZ7
WP_003759050.1.12310 WP_003759050.1.15766 WP_003759050.1.35723 WP_003759050.1.36748 WP_003759050.1.43364 WP_003759050.1.45294 WP_003759050.1.54663 WP_003759050.1.63715 WP_003759050.1.75975 WP_003759050.1.82995 WP_003759050.1.84299 WP_003759050.1.86843 WP_003759050.1.89280 WP_003759050.1.90457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]