SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1S1W983 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S1W983
Domain Number 1 Region: 389-648
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.71e-86
Family Capz alpha-1 subunit 0.00000345
Further Details:      
 
Domain Number 2 Region: 73-277
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.16e-64
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.00000043
Further Details:      
 
Domain Number 3 Region: 262-387
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.96e-34
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0000566
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1S1W983
Sequence length 656
Comment (tr|A0A1S1W983|A0A1S1W983_9PEZI) 2-oxoisovalerate dehydrogenase e1 beta subunit {ECO:0000313|EMBL:OHX01266.1} KW=Complete proteome OX=1573173 OS=Colletotrichum incanum. GN=CSPAE12_00070 OC=Colletotrichum.
Sequence
MRSSISIRPLRRALAPSASTQLPLAASRLYSTHPPNAKLNIPVDYATTSLLAHSSQTALS
TAELPAEVRNGTTKKMNLFQAINDALSIALAEDDSVMVFGEDVAFGGVFRCTMKLAETYG
ADRIFNTPLTEQGIMGFAIGAAAEGMRPVAEIQFADYIYPAFDQLVNEAAKYRYRDGACG
RSVGGLTVRMPCGGVGHGALYHSQSPESLFTHIPGLRVIMPRSPLQAKGLLLSAIRSNDP
CIFMEPKILYRAAVEQVPAGAYTLPLSKAEVLKEGKDVTIISYGQPLYTCMSAIRRAEED
LGISVELIDLRTLYPWDKETVLESVRKTGHCIVVHEAMVNAGIGAEVAATIQEDPDTFLR
LEAPVARVAGWSIHTPLLYEKFNIPDVAIETVSSFVEGAPPGELADVIADIKSLTISDPE
IVSSLEPAFEKYNEEQFVTVKLPGGSQQVIISSHSSLGDGQYFDVESSTSFSFDHTTQKA
SNVQSYVLESANADLIKSTLKSLGPYVQEHFPNAAYGVYPTANDTQVAVIIVSNKYSPNN
FWNGRWRSLYIFDPSSSNLEGSVKVDVHYYEDGNVRLLTNRPSQASVSSGTGAGIVKEIS
TSEKKYQEELNRGFTNLSEGAFKGLRRQLPVTRQKIEWDKITSYRLGQDIGGGARR
Download sequence
Identical sequences A0A1S1W983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]