SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S2N5Y3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S2N5Y3
Domain Number 1 Region: 7-73
Classification Level Classification E-value
Superfamily N-terminal, cytoplasmic domain of anti-sigmaE factor RseA 0.00000000000327
Family N-terminal, cytoplasmic domain of anti-sigmaE factor RseA 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1S2N5Y3
Sequence length 99
Comment (tr|A0A1S2N5Y3|A0A1S2N5Y3_9BURK) Uncharacterized protein {ECO:0000313|EMBL:OIJ40471.1} KW=Complete proteome OX=47229 OS=Massilia timonae. GN=LO55_3189 OC=Oxalobacteraceae; Massilia.
Sequence
MDTNRKLREQISALKDGALLDADLELALAALQGSDGRQAWDLYHLIGDTLRDTAAPALSP
AFNARLAERLAGEPPPLRRAAVAAESTGLAAVLAKTASS
Download sequence
Identical sequences A0A1S2N5Y3 K9DC33
WP_005666817.1.28227 WP_005666817.1.73060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]