SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S2NG62 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S2NG62
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 9.42e-31
Family Frataxin-like 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1S2NG62
Sequence length 109
Comment (tr|A0A1S2NG62|A0A1S2NG62_9BURK) Iron-sulfur cluster assembly protein CyaY {ECO:0000256|HAMAP-Rule:MF_00142, ECO:0000256|SAAS:SAAS01015787} KW=Complete proteome OX=47229 OS=Massilia timonae. GN=LO55_1048 OC=Oxalobacteraceae; Massilia.
Sequence
MTETEFLDLADLTLKQIEDAFDRLNDEDVIDVECKRSGNVLEIEFIDNGSKIIVNSQAPL
QEMWVAARSGGYHYKRVGDEWRNTRDDSEFFASLSRYASEQGGAQVSLV
Download sequence
Identical sequences A0A1S2NG62
WP_071360707.1.73060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]