SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S2ZTY8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S2ZTY8
Domain Number 1 Region: 13-213
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.52e-24
Family Protein-L-isoaspartyl O-methyltransferase 0.003
Further Details:      
 
Weak hits

Sequence:  A0A1S2ZTY8
Domain Number - Region: 341-358
Classification Level Classification E-value
Superfamily SOCS box-like 0.0929
Family SOCS box-like 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1S2ZTY8
Sequence length 360
Comment (tr|A0A1S2ZTY8|A0A1S2ZTY8_ERIEU) protein-L-isoaspartate O-methyltransferase domain-containing protein 2 {ECO:0000313|RefSeq:XP_007524502.1, ECO:0000313|RefSeq:XP_016044237.1} KW=Complete proteome; Reference proteome OX=9365 OS=Erinaceus europaeus (Western European hedgehog). GN=PCMTD2 OC=Erinaceinae; Erinaceus.
Sequence
MGGAVSAGEDNDELIDNLKEAQYIRTELVEQAFRAIDRADYYLEEFKENAYKDLAWKHGN
IHLSAPCIYSEVMEALDLQPGLSFLNLGSGTGYLSSMVGLILGPFGVNHGVELHSDVIEY
AKQKLDFFIRTSDSFDKFDFCEPSFVTGNCLEISPDCSQYDRVYCGAGVQKEHEEYMKNL
LKVGGILVMPLEEKLTKITRTGPSAWETKKILAVSFAPLIQPCHSESGRSRLVHLPPLAV
RSLQDLARIAIRGTIKKIINQETVIKNGNGLKNTPRFKRRRVRRRRMETIVFLDKEVFAS
RISNPSDDNSCEDLEEEGREEEKTQTESKPDPPVNFLREKVLSLPLPEPLKYYLLYYREK
Download sequence
Identical sequences A0A1S2ZTY8
ENSEEUP00000003373 XP_007524502.1.11023 XP_016044237.1.11023 ENSEEUP00000003373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]