SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1S2ZZK3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S2ZZK3
Domain Number 1 Region: 128-375
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 8.89e-103
Family Capz alpha-1 subunit 0.000000000976
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1S2ZZK3
Sequence length 380
Comment (tr|A0A1S2ZZK3|A0A1S2ZZK3_ERIEU) F-actin-capping protein subunit alpha-1 {ECO:0000313|RefSeq:XP_007527020.1} KW=Complete proteome; Reference proteome OX=9365 OS=Erinaceus europaeus (Western European hedgehog). GN=CAPZA1 OC=Erinaceinae; Erinaceus.
Sequence
MADFEDRVSDEEKVRGPPHSPPSSCYGEQGPDPAAVGSLAASPGRKSFLALAGLRFRSRD
TSLLRGFPPPHGGSSSPFLNSLFSSRTGGVALWLSCERSDFALLDRDCGLASVTKKGLIV
MSRRLSKSNVRLLLNNDNLLREGAAHAFAQYNMDQFTPVKIEGYEEQVLITEHGDLGNSR
FLDPKNKISFKFDHLRKEASDPHPEEADGGLKSWRESCDSALRAYVKDHYSNGFCTVYAK
TIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFTITPPTAQVVGVLKIQVHYYEDGNVQL
VSHKDVQDSVTVSNEVQTAKEFIKIIEHAENEYQTAISENYQTMSDTTFKALRRQLPVTR
TKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences A0A1S2ZZK3
XP_007527020.1.11023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]