SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3AFU4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3AFU4
Domain Number 1 Region: 92-164
Classification Level Classification E-value
Superfamily Bcl-2 inhibitors of programmed cell death 0.0000281
Family Bcl-2 inhibitors of programmed cell death 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1S3AFU4
Sequence length 170
Comment (tr|A0A1S3AFU4|A0A1S3AFU4_ERIEU) peroxisomal testis-specific protein 1 {ECO:0000313|RefSeq:XP_007534318.1} KW=Complete proteome; Reference proteome OX=9365 OS=Erinaceus europaeus (Western European hedgehog). GN=PXT1 OC=Erinaceinae; Erinaceus.
Sequence
MPPPGTGRLCRSGARPSPGSVCVATRLSHSPFHRNSMKSKQHLAIVCDSKQVLNLGSEVT
NCCKSLKVNYRVQESYMTRLVSSLPVSTMSGDPDHSSPSHFENNTGQNHHQEEIINKLAL
KLRNIGDSIDHEVRHQNLQQEDRDAFAHFVIFSFGGVHVLLRFLWNDHLM
Download sequence
Identical sequences A0A1S3AFU4
XP_007534318.1.11023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]