SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1S3E3S3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3E3S3
Domain Number 1 Region: 2-248
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.06e-72
Family Capz beta-1 subunit 0.000000273
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1S3E3S3
Sequence length 256
Comment (tr|A0A1S3E3S3|A0A1S3E3S3_CICAR) probable F-actin-capping protein subunit beta {ECO:0000313|RefSeq:XP_012570093.1} KW=Complete proteome; Reference proteome OX=3827 OS=Cicer arietinum (Chickpea) (Garbanzo). GN=LOC101502862 OC=Cicereae; Cicer.
Sequence
MEAAMGLMRRIPPKHTETALSALLSLMPHXXSDLLSQVDQPLQVLCDVDCGKEFILCEYN
RDADSYRSPWSNKYHPPLEDGSLPSSKLRKLEIEANEIFAIYRDQYYEGGISSVYMWEDE
NEGFVACFLIKKDGSKTGQGRRGYLEEGAWDAIHVIEVGPEEEEITNYRLTSTVMLTLTT
NNESSGTFSLSGSIRRQMSMKLSVAEGHLCNMGRMIEEMESKLRNSLDQVYFGKTREMVC
TLRPPTEVAQMRMPES
Download sequence
Identical sequences A0A1S3E3S3
XP_012570093.1.79386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]