SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3GJY3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3GJY3
Domain Number 1 Region: 265-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 3-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.92e-22
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 3 Region: 153-210
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.71e-22
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 4 Region: 307-359
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-19
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 5 Region: 209-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.73e-19
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 6 Region: 118-167
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-18
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1S3GJY3
Sequence length 367
Comment (tr|A0A1S3GJY3|A0A1S3GJY3_DIPOR) zinc finger protein 558-like isoform X2 {ECO:0000313|RefSeq:XP_012889015.1, ECO:0000313|RefSeq:XP_012889016.1} KW=Complete proteome; Reference proteome OX=10020 OS=Dipodomys ordii (Ord's kangaroo rat). GN=LOC105998767 OC=Heteromyidae; Dipodomyinae; Dipodomys.
Sequence
MGWTRDLVTFKDVAVEFSQEEWALLDTWQRTLYSEVTLENCRNLVSLGCHVDVPSLAAQL
ELCPQVGTEESGVVQDTCAELEHALQAKWLSPEKHVFRRQQSKHGKTDSGHGRANVNECS
QCFKVFSTKSNLTQHQRTHTGEKPYGCTECGKAFSSRSYLTIHRRIHNGEKPFACRHCGK
AFSDPSSLRLHVRIHTGEKPYACGQCSHVFRTSCNLKSHTRTHGGESHHECRQCGKAFST
RSSLTGHRSVHTGEKPFACGLCGKTFRKSSYLTQHARTHTGEKPYACAHCGKAFSSSFSL
TVHKRTHTGEKPYACADCGKAFNNLSAVKKHVRTHTGEKPYACAHCGKAFTSNSYLSVHQ
RLHSQWT
Download sequence
Identical sequences A0A1S3GJY3
XP_012889015.1.60039 XP_012889016.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]