SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3MXN8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3MXN8
Domain Number 1 Region: 66-94
Classification Level Classification E-value
Superfamily Moesin tail domain 0.0000017
Family Moesin tail domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1S3MXN8
Sequence length 97
Comment (tr|A0A1S3MXN8|A0A1S3MXN8_SALSA) ermin-like {ECO:0000313|RefSeq:XP_014007937.1} KW=Complete proteome; Reference proteome OX=8030 OS=Salmo salar (Atlantic salmon). GN=LOC106575780 OC=Salmoniformes; Salmonidae; Salmoninae; Salmo.
Sequence
MEGTPQETKLGTGVSTGQPVKGAGPNTFTKPRENHEEPEEECEEEEEGGGRQSGGRQYPD
KKPGSKNASKYSTVSYRKIRKGNTKQRVDEFESMCIP
Download sequence
Identical sequences A0A1S3MXN8
XP_014007937.1.97760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]