SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3N349 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3N349
Domain Number 1 Region: 3-146
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 9.01e-60
Family Crystallins/Ca-binding development proteins 0.0000362
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1S3N349
Sequence length 154
Comment (tr|A0A1S3N349|A0A1S3N349_SALSA) gamma-crystallin M2-like isoform X3 {ECO:0000313|RefSeq:XP_014009894.1} KW=Complete proteome; Reference proteome OX=8030 OS=Salmo salar (Atlantic salmon). GN=LOC106576888 OC=Salmoniformes; Salmonidae; Salmoninae; Salmo.
Sequence
MHSHFSRCNSIRVDSGCWVAYEKSNYSGYQYMLTRGKYPDHHRWSGFNDCIRSCRIIPAY
NGNYRMKIFERSDFGGKMMELSDDCPNLQDRFHLRDISSCNVMEGYWILHEHPNYRGRQY
FLRPGEYNKHSDWGSMSSTSGSVRRVIELKQTNQ
Download sequence
Identical sequences A0A1S3N349
XP_014009894.1.97760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]