SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3W3A9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3W3A9
Domain Number 1 Region: 16-84
Classification Level Classification E-value
Superfamily Interleukin 8-like chemokines 2.75e-19
Family Interleukin 8-like chemokines 0.0000622
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1S3W3A9
Sequence length 87
Comment (tr|A0A1S3W3A9|A0A1S3W3A9_ERIEU) C-C motif chemokine 4 isoform X2 {ECO:0000313|RefSeq:XP_016040973.1} KW=Complete proteome; Reference proteome OX=9365 OS=Erinaceus europaeus (Western European hedgehog). GN=LOC103108093 OC=Erinaceinae; Erinaceus.
Sequence
MKLWVSVLSLLMLMAAFCSPAFSAPIGSDPPTACCFSYTLRKLPRNFVMDYFETSSLCSQ
PAVVGRQICANPSEPWVQEYMDDLELN
Download sequence
Identical sequences A0A1S3W3A9
XP_016040973.1.11023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]