SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3ZGD3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3ZGD3
Domain Number 1 Region: 76-151
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 6.93e-32
Family Skp1 dimerisation domain-like 0.0000324
Further Details:      
 
Domain Number 2 Region: 2-62
Classification Level Classification E-value
Superfamily POZ domain 1.52e-21
Family BTB/POZ domain 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1S3ZGD3
Sequence length 153
Comment (tr|A0A1S3ZGD3|A0A1S3ZGD3_TOBAC) SKP1-like protein 1A {ECO:0000313|RefSeq:XP_016463520.1} KW=Complete proteome; Reference proteome OX=4097 OS=Nicotiana tabacum (Common tobacco). GN=LOC107786549 OC=Nicotianoideae; Nicotianeae; Nicotiana.
Sequence
MKMIVLRSSDGETFEVEESVALESQTIKHMIEDDCADTSIPLPNVTSKILAKVIEYCKRH
VDAASKTEDKAVEDDLKAFDADFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKG
KTPEEIRKTFNIKNDFTPEEEEEVRRENAWAFE
Download sequence
Identical sequences A0A1J6KBZ0 A0A1S3ZGD3 A0A1U7WLY7 O82463
XP_009779583.1.57364 XP_016463520.1.3737 XP_019235242.1.74238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]