SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1S4F0Y0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S4F0Y0
Domain Number 1 Region: 3-262
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.31e-95
Family Capz beta-1 subunit 0.0000000017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1S4F0Y0
Sequence length 275
Comment (tr|A0A1S4F0Y0|A0A1S4F0Y0_AEDAE) F-actin capping protein beta subunit {ECO:0000313|VectorBase:AAEL002184-PA} OX=7159 OS=Aedes aegypti (Yellowfever mosquito) (Culex aegypti). GN= OC=Culicidae; Culicinae; Aedini; Aedes; Stegomyia.
Sequence
MTEQQMDCALDLMRRLPPQQIEKNLIDLIDLAPALCEDLLTSVDQPLKIAKDKETGKDYL
LCDYNRDGDSYRCPWTNTYDPPLEDGSMPSERLRKLEIEANHAFDQYREMYYEGGVSSAY
LWDLDHGFAGVILIKKAGEGNQKTKGCWDSIHVVEVQEKSSGRTAHYKLTSTAMLWLQTH
KQGSGTINLGGSLTRQVEQDAPVSESSPHIANIGRLVEDMENKIRNTLNEIYFGKTKDIV
NGLRSIQKLADTNQQASMKKELALALLRRTGKGEN
Download sequence
Identical sequences A0A1S4F0Y0
XP_001654929.2.48696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]