SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S7HIL8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S7HIL8
Domain Number 1 Region: 12-74
Classification Level Classification E-value
Superfamily Preprotein translocase SecE subunit 1.09e-17
Family Preprotein translocase SecE subunit 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1S7HIL8
Sequence length 75
Comment (tr|A0A1S7HIL8|A0A1S7HIL8_9SACH) SSS1 (YDR086C) {ECO:0000313|EMBL:AQZ12871.1} KW=Complete proteome OX=1365886 OS=Zygosaccharomyces parabailii. GN=BZL39_E02100 OC=Zygosaccharomyces.
Sequence
MAKAAEKTENNQIDKLAEAPLEFVKEGSQFLSKCKKPDMKEYTKIVRAVGIGFVSVGVIG
YAIKLIHIPIRYLIV
Download sequence
Identical sequences A0A1S7HIL8 A0A212M3E9 S6ENV5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]