SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S8VCZ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S8VCZ7
Domain Number 1 Region: 1-63
Classification Level Classification E-value
Superfamily POZ domain 3.66e-19
Family BTB/POZ domain 0.0004
Further Details:      
 
Domain Number 2 Region: 79-117
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.00000000000144
Family Skp1 dimerisation domain-like 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1S8VCZ7
Sequence length 131
Comment (tr|A0A1S8VCZ7|A0A1S8VCZ7_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:OOM99883.1} KW=Complete proteome; Reference proteome OX=1357716 OS=Batrachochytrium salamandrivorans. GN=BSLG_09270 OC=Rhizophydiales incertae sedis; Batrachochytrium.
Sequence
MVRLSSSDAQEFTVAKDIAYQSVLIKNMLEDLGDDEDASIPLPNVAGTVLAKVIDYATHH
KDDVPPPPEDENKNITKSSEDIDEWDKEFINVDQGTLFEIILAANYLDMKGLLDLGTWYL
LSGGDMQIKCS
Download sequence
Identical sequences A0A1S8VCZ7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]