SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1S8VM96 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S8VM96
Domain Number 1 Region: 4-272
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.03e-74
Family Capz alpha-1 subunit 0.00000331
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1S8VM96
Sequence length 316
Comment (tr|A0A1S8VM96|A0A1S8VM96_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:OON02983.1} KW=Complete proteome; Reference proteome OX=1357716 OS=Batrachochytrium salamandrivorans. GN=BSLG_06609 OC=Rhizophydiales incertae sedis; Batrachochytrium.
Sequence
MTTSDADKLEIVTGFIKDSPPGEINDVFNDVRSLLGDDALLQTVVDSTLADHHAQQFISV
KVPNKDYEVILGKHGLVGTNSYIDPRSGQLLTVDLVHQTVQKAEPFDSKSPAHLLEQRAA
LDSAIEEYTSSFYPSSVSTVWIANDDSLVVAIVANKYHPDSFWSGRWRSQWTIHPSSSLL
TGFAKVQVHYYEDGNVQHNSVKEYSLTINASDDPATLAATVVKHISKTEAEYQTTLNDGH
AHFASETFKSLRRALPVSRTKIEWQGILSCKLKDMLRACYRSPFEYTTIVTVSIIFEFIE
IELFFLDKIGSELVSK
Download sequence
Identical sequences A0A1S8VM96

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]