SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1S9DV54 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S9DV54
Domain Number 1 Region: 785-1032
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.75e-82
Family Capz beta-1 subunit 0.000000124
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1S9DV54
Sequence length 1043
Comment (tr|A0A1S9DV54|A0A1S9DV54_ASPOZ) WASH complex, F-actin capping protein, beta subunit {ECO:0000313|EMBL:OOO12963.1} KW=Complete proteome; Reference proteome OX=5062 OS=Aspergillus oryzae (Yellow koji mold). GN=OAory_01007120 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MWQKVFGHSQNKPMGMSQYTYRPLAKGTTKIRLLRLLPHENKAARVECELIEYTLTDSVG
QHPYEALSYVWGIGGGPQSILIDGRAFRVTQNLHSVLLRLRNHSVVRLLWIDAICINQKD
DREKSHQIQLMRTIYGEAWRVIVWLGEEADQSSEALEAIRKAAEDASVDDLPKGYSRDRP
DREKHLPSSLALVQRPWFQRIWVLQEVALARDIIIMCGPVEMNGYAFISGLQSLEVLRTA
QPKLQGLVQSAYYLIKDAVFRPSYRFNTRGTLSIGELIDMYHTRHASCLHDKVYALLGMC
SDDPSTDALRPNYQLPWSKVFERVIKHIISQDISVKTWPDREAAVIRGKGYMLGIIKSVA
TPGSRYDRQEVKVLFRDTVEALYLYMTSGVQWLLQTPAEPIRAGDIVCLLQGASAPTIVR
ISDSGLRIIMSSVVPRHKAIHGTSKYVPQGPPSEASVLHDLVLQWDWAPTLDSLQEKNRA
TAPREPHNSQPSISRSHHEDGLHNPTVLHDILTIAVPSKYNVLTSDVCGIGGAPDGASAM
KALLDQAGDILPITEDIVRKAADHHDLSADLLKILFEHRGDTLPVTEQVVKAAAGNPDAH
FVMTLLFKKRGDSLPITEEVVKAAAGKPESGGRILEILFKERGDILVITESVVIAAAGNQ
KGGASIIQYLFEQKGESLPITEAVLIAAATNPAPFNAPRTFKRELSPAIYPDDSDIPDLT
AATLARVKDNCHGPNHPTTHLRSGQLEIGLQNGVNNNTNQTFAEAYPPWLTLNLTVRCRE
LTVIATSDLLRRLNPRDTKKNLQAITSIVPDLTEDLLSSVDQPLEIRRCSKTKRDYLLCD
YNRDGDSYRSPWSNEFDPPLDDGTVPSERVRKLEVAANEAFDVYRELYYEGGVGSVYFWD
LDDGFAGVILLKKGVTPGAKSSGEWDSIHVFEATDRARMSHYKLTSTVILHLANETESLG
EMDLSGNMTRQVEVDLPVESDASHVANVGRLVEDMELKMRNLLQEVYFGKAKDVVGELRS
LASLSEASKERATQREMIMSMHR
Download sequence
Identical sequences A0A1S9DV54

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]