SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1S9DXX6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S9DXX6
Domain Number 1 Region: 2-265
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.53e-87
Family Capz alpha-1 subunit 0.00000364
Further Details:      
 
Domain Number 2 Region: 288-449
Classification Level Classification E-value
Superfamily HAD-like 3.19e-20
Family YihX-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1S9DXX6
Sequence length 730
Comment (tr|A0A1S9DXX6|A0A1S9DXX6_ASPOZ) HAD-superfamily hydrolase subfamily IA variant 3 {ECO:0000313|EMBL:OOO13914.1} KW=Complete proteome; Reference proteome OX=5062 OS=Aspergillus oryzae (Yellow koji mold). GN=OAory_01025090 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MASTVDIASSFIEGAPPGELADVVADVKTLTSNGADIIPSLAPAFERYNETQLATVKLPG
ASQEVLISEYNKLDGNRYFDVESQTSFEVDHVTQEASAAQSYVLDSQNADLIKSLLKSLG
AHAREHYPNCAYGVYPIENDSAVAILLVSNRYSPNNFWNGRFRATYQFPVSEPTTVTGKI
QVDVHYYEDGNVALNTNKPLNLSVSSLSAESIISRIATAERDYQEDLNRAFVQMAEGAFK
GLRRQLPITRQKVEWEKVGGYRLGQDISGGGVILTWDLPEDTVISAQIFKRMLTSQTWSD
YERGNLSENGCYQRLAEDFGIDSADIAHTVRQARESLVTDTAIMNIISEIRAGANHIAIF
AMSNISQPDYAALLLDHRGMCSFDRVFPSGCYGTRKPELSFYNKVLREIDTPPENVIFVD
DQLENVISAQSIGIHGIAYTNAAELGRQLRNLIFDPVERGREFLRRNAGEFHSITETDQI
VRENFSQLLILEATGDKSLVSLEYHQKSWNFFQGNPILTTETFPDDVDTTSLALMTLPTD
TKTANLLLDQILGLVNADGIVTTYFDQTRERIDPVVCVNVLRLFCTYGRGIALPLTLQWV
YDVLAHRAYINGTRYYTSPESFLYFVGQLCRFSTGVLALRPLETLLIDRLKERLQVKADP
LSLAMRILTCLSVGVSQVEVDLRELLSMQCEDGSWEHCPFTRYGLSKVSIGNRGLTTAFV
VKAVEMCRGS
Download sequence
Identical sequences A0A1S9DXX6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]