SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1T1DQC9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1T1DQC9
Domain Number - Region: 90-152
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0105
Family Pseudo ankyrin repeat 0.025
Further Details:      
 
Domain Number - Region: 14-38
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.0693
Family EB1 dimerisation domain-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1T1DQC9
Sequence length 188
Comment (tr|A0A1T1DQC9|A0A1T1DQC9_9LEPT) Transposase {ECO:0000313|EMBL:OOV43068.1} KW=Complete proteome OX=561005 OS=Leptospira kirschneri serovar Pomona. GN=B1J93_08820 OC=Bacteria; Spirochaetes; Leptospirales; Leptospiraceae; Leptospira.
Sequence
MKNARLKQIKMDALSARALYRDRLFYFNSLKNIYMLISICGSISFLGALYIAHGTYFQNS
IEFISTILSIITILYAVITLIYKYDDNIIISKNGIRNNTFIASEVDSAISTNKKESELQW
FYRYVSQIDTEDNDFFSGLKIVHKQKAYREALKESTIGNIENLCAKCNRSPWDYEKGDCQ
LCGNKSKK
Download sequence
Identical sequences A0A1T1DQC9 M6VIA4 S5VT49
WP_002177309.1.28695 WP_002177309.1.55840 WP_002177309.1.85491 WP_002177309.1.95810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]