SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1T3C5I2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1T3C5I2
Domain Number 1 Region: 3-263
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.44e-86
Family Capz alpha-1 subunit 0.00000538
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1T3C5I2
Sequence length 272
Comment (tr|A0A1T3C5I2|A0A1T3C5I2_9HYPO) F-actin-capping protein subunit alpha {ECO:0000313|EMBL:OPB36356.1} KW=Complete proteome OX=1491466 OS=Trichoderma guizhouense. GN=A0O28_0054350 OC=Trichoderma.
Sequence
MSHIETVSSFVQGAPPGELGDVVADIKALTASEPNIVDELAPAFERYNEEQFITLKLPGS
SQPVLISPHNSLGGGRYYDVESSSSFEVDHVAQKASAVQSYVLEGSQADLVKSTLKSLGG
YVKEHFPNAALGAYPVESDSKVAVVVVANKYSPNNFWNGRWRSVYTFDPSSGNLEGTIMV
DVHYYEDGNVRLLTNKAVSASIPSGTGAGIVKEIASIEKKYQEDLNRSFVSLSEGAFKGL
RRQLPVTRQKIEWDRVTGYRLGQDIGGGSSKR
Download sequence
Identical sequences A0A1T3C5I2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]