SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1T3EU34 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1T3EU34
Domain Number - Region: 143-182
Classification Level Classification E-value
Superfamily Expressed protein At2g23090/F21P24.15 0.0432
Family Expressed protein At2g23090/F21P24.15 0.008
Further Details:      
 
Domain Number - Region: 9-90
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0445
Family Capz alpha-1 subunit 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1T3EU34
Sequence length 228
Comment (tr|A0A1T3EU34|A0A1T3EU34_ELIME) Uncharacterized protein {ECO:0000313|EMBL:AQX46166.1} OX=238 OS=Elizabethkingia meningoseptica (Chryseobacterium meningosepticum). GN=B5G46_02145 OC=Flavobacteriaceae; Elizabethkingia.
Sequence
MNTLEKKKIQKYLEDKRLPLDLYMEIEDHIISQIEELENNGIGFQEAFLQVQSKWKKELS
FQNFNLTDIKAVPKIVERIRKAFIRETFPKVLFLSLLVSLIMVVGAYQLDKENFTTFYTS
VYIGVQSISALAFIINSKTILLKNKYKKQQLNAYQKMVNSCVGLCMFPFMMTMNAPKCSE
NFFNTLHQETNWKILLELLFIIYFSSISLFSAFVFIKYKKEVAKMKLA
Download sequence
Identical sequences A0A1T3EU34
WP_016200061.1.30997 WP_016200061.1.40770 WP_016200061.1.54035 WP_016200061.1.59614 WP_016200061.1.75841 WP_016200061.1.91748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]