SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1T4LFB3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1T4LFB3
Domain Number - Region: 62-108
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0628
Family Capz alpha-1 subunit 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1T4LFB3
Sequence length 137
Comment (tr|A0A1T4LFB3|A0A1T4LFB3_PORCN) PcfK-like protein {ECO:0000313|EMBL:SJZ53258.1} KW=Complete proteome OX=36874 OS=Porphyromonas cangingivalis. GN=SAMN02745205_01121 OC=Porphyromonadaceae; Porphyromonas.
Sequence
MKGTEHFKDVIQNYLETRASYDELFAGNFRKENKNIDECITYILTEVQRMGCAGLSDEEV
YSLAVHYYDEDNIKVGTSINCQVVVNHTIELTEEEKAEARKKAIERYQAEEYRKLTAKKP
KAEKQAEEQLQPSLFEF
Download sequence
Identical sequences A0A0A2F289 A0A0K2J5X2 A0A1T4LFB3 A0A2D2MUW4 T2NAM9
WP_004584358.1.10894 WP_004584358.1.17731 WP_004584358.1.19579 WP_004584358.1.22258 WP_004584358.1.25639 WP_004584358.1.27553 WP_004584358.1.48721 WP_004584358.1.5238 WP_004584358.1.58990 WP_004584358.1.91293 WP_004584358.1.94381 WP_004584358.1.97153 WP_004584358.1.97339 gi|334146829|ref|YP_004509757.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]