SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1U7KPJ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7KPJ9
Domain Number 1 Region: 3-240
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 6.15e-67
Family Capz alpha-1 subunit 0.0000193
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1U7KPJ9
Sequence length 253
Comment (tr|A0A1U7KPJ9|A0A1U7KPJ9_9APHY) F-actin-capping protein subunit alpha {ECO:0000313|EMBL:OKY63705.1} KW=Complete proteome; Reference proteome OX=98765 OS=Phlebia centrifuga. GN=PHLCEN_2649 OC=Agaricomycetes; Polyporales; Meruliaceae; Phlebia.
Sequence
MDAEERIQAASKFLLQSPPGEINDVLNGDEAARVPGADSEEEDDRFWDPRSRTSFRFDHI
ALEASEPEPIEPEEEAEPFRIALEIAALTYLSAHFHGGVTSVFSTQGNPHRFTIQVVANK
YNPSNFWSGRWRSEYIVNLQERKLEGKILLNVHYYEQGNVQLSTTHAVSIELPPTISSSN
ASASASKILAVIESEESKYQASLNEAYQDMGDKTFKGLRRALPMTRAKLDWDRVLGYKIG
AELTANKGAFGSS
Download sequence
Identical sequences A0A1U7KPJ9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]