SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U7QQB6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7QQB6
Domain Number 1 Region: 9-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.42e-24
Family KRAB domain (Kruppel-associated box) 0.00079
Further Details:      
 
Domain Number 2 Region: 198-255
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.21e-21
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 3 Region: 368-425
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-21
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 4 Region: 311-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.82e-21
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 5 Region: 254-312
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.15e-21
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 6 Region: 425-481
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.36e-19
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 7 Region: 468-528
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.73e-19
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 8 Region: 160-212
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.81e-19
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1U7QQB6
Sequence length 541
Comment (tr|A0A1U7QQB6|A0A1U7QQB6_MESAU) zinc finger protein 778-like {ECO:0000313|RefSeq:XP_005078630.1, ECO:0000313|RefSeq:XP_012974856.1} KW=Complete proteome; Reference proteome OX=10036 OS=Mesocricetus auratus (Golden hamster). GN=LOC101836995 OC=Muroidea; Cricetidae; Cricetinae; Mesocricetus.
Sequence
MVADCLTNCYQVSVTFDDVAVDFTQEEWILLDQAHRDLYREVMLENYQNLASAGCEVIKP
SLISWLEEEDLHREDLQEWEMPLGTKESTLCQEFLRRQTSSGIQTVRSHSAQELCYYVQC
GEIFSEHSYFKTHVKTHSTCNTGHFTHSSHDASVQEHTIKTYPCKICGKAFGRSSNLNRH
LRSHTGEKPYECKECGKAFTTYSRLVEHFRTHTGEKPYKCKDCGKAFAKRSGLITHISTH
ASEKPFACKECGKAFASSPRLSQHVRIHSGERPYICKDCGRAFLTSSYLRNHIGRTHSGE
RPYLCGECGKAFHSYSNLRRHVRTHSGERPYICKECGKAFLNSSYLHNHVRKTHSGEMPH
ICGECGKVFHASSYLRRHLRTHSGERPCICKECGKAFLNSSYLRKHLTIHTGDKPYECKE
CGKAYRRYNLLHDHLKTHTVEKPFECDVCGKSFQYFSYLTKHVRIHTGTKPYKCKYCGKD
FTTSSSRTEHIRTHTGERPYECTECEKTFTSSSNLIHHVKIHTREKPFVENVGKPTADFT
Y
Download sequence
Identical sequences A0A1U7QQB6
XP_005078630.1.91757 XP_012974856.1.91757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]