SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U7R3M4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7R3M4
Domain Number 1 Region: 6-61
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 4.05e-19
Family Transducin (heterotrimeric G protein), gamma chain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1U7R3M4
Sequence length 68
Comment (tr|A0A1U7R3M4|A0A1U7R3M4_MESAU) Guanine nucleotide-binding protein subunit gamma {ECO:0000256|RuleBase:RU004973} KW=Complete proteome; Reference proteome OX=10036 OS=Mesocricetus auratus (Golden hamster). GN=Gng10 OC=Muroidea; Cricetidae; Cricetinae; Mesocricetus.
Sequence
MSSGASVSALQRLVEQLKLEAGVERIKVSQAAAELQQYCMQNACKDALLLGVPAGSNPFR
EPRSCALL
Download sequence
Identical sequences A0A061IIE7 A0A1U7R3M4
XP_003510621.2.69978 XP_005085113.1.91757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]