SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U7RCB5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1U7RCB5
Domain Number - Region: 166-204
Classification Level Classification E-value
Superfamily Troponin coil-coiled subunits 0.0235
Family Troponin I 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1U7RCB5
Sequence length 244
Comment (tr|A0A1U7RCB5|A0A1U7RCB5_MESAU) schwannomin-interacting protein 1 isoform X2 {ECO:0000313|RefSeq:XP_005085757.1} KW=Complete proteome; Reference proteome OX=10036 OS=Mesocricetus auratus (Golden hamster). GN=Schip1 OC=Muroidea; Cricetidae; Cricetinae; Mesocricetus.
Sequence
MVHQENCSYQAQKNERESIRQKLALGSFFDDGPGIYTSCSKSGKPSLSSRLQSGMNLQIC
FVNDSGSDKDSDADDSKTETSLDTPLSPMSKQSSSYSDRDTTEEESESLDDMDFLTRQKK
LQAEAKMALAMAKPMAKMQVEVEKQNRKKSPVADLLPHMPHISECLMKRSLKPTDLRDMT
IGQLQVIVNDLHSQIESLNEELVQLLLIRDELHTEQDAMLVDIEDLTRHAESQQKHMAEK
MPAK
Download sequence
Identical sequences A0A0P6JYP2 A0A151NB82 A0A1U7RCB5 A0A286XMU8 A0A2K5BUC5 A0A2K6SRK9 F6SE68 K7FV09
XP_004281898.1.21590 XP_004323023.1.83887 XP_004652448.1.11716 XP_004834585.1.39548 XP_005085757.1.91757 XP_005287067.1.60341 XP_005393174.1.28644 XP_006123510.1.96668 XP_006190501.1.101512 XP_006861846.1.41390 XP_006887703.1.29581 XP_007063150.1.26238 XP_007187134.1.59432 XP_007454191.1.90284 XP_007946951.1.48129 XP_008845485.1.79516 XP_010334033.1.74449 XP_012302770.1.9421 XP_012498379.1.63892 XP_012638207.1.48125 XP_012663280.1.62490 XP_016004469.1.101085 XP_019358765.1.87953 ENSPSIP00000011869 ENSCJAP00000000720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]