SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U7T2F5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7T2F5
Domain Number 1 Region: 25-96
Classification Level Classification E-value
Superfamily Interleukin 8-like chemokines 2.36e-26
Family Interleukin 8-like chemokines 0.0000358
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1U7T2F5
Sequence length 97
Comment (tr|A0A1U7T2F5|A0A1U7T2F5_TARSY) C-C motif chemokine {ECO:0000256|RuleBase:RU361150} KW=Complete proteome; Reference proteome OX=1868482 OS=Tarsius syrichta (Philippine tarsier). GN=CCL11 OC=Tarsiiformes; Tarsiidae; Carlito.
Sequence
MKVSAALLWLLLTAATFSSQVFAQPAFVPRTCCFTLTNRKIPIQRLESYRKISSSKCPRK
AVIFKTKLNKDICADPKEKWVQNYIKYLDQKSSTSKP
Download sequence
Identical sequences A0A1U7T2F5
XP_008047112.1.4292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]