SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1U7WD81 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7WD81
Domain Number 1 Region: 2-244
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.75e-74
Family Capz beta-1 subunit 0.000000432
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1U7WD81
Sequence length 254
Comment (tr|A0A1U7WD81|A0A1U7WD81_NICSY) probable F-actin-capping protein subunit beta {ECO:0000313|RefSeq:XP_009775201.1} KW=Complete proteome; Reference proteome OX=4096 OS=Nicotiana sylvestris (Wood tobacco) (South American tobacco). GN=LOC104225131 OC=Nicotianoideae; Nicotianeae; Nicotiana.
Sequence
MEAAMGLMRRIPPKHTETALSALLSLLPHHSSDLLSQVDQPLQVLCDMEYGKEFILCEYN
RDADSYRSPWSNKYHPPLEDAPQPSPELRKLEVEANEVFAIYRDQYYEGGISSVYMWEDE
NEGFVACFLIKKDGSKSGHGRRGYLQEGAWDAIHVIEVGPEEEGIAQYCLTSTVMLTLTT
DNESSGSFNLSGSIRRQMSMKLSVSDGHLCNMGKMIEEMEGKLRNSLDQVYFGKTKEMVC
TLRPPAELVTLPDS
Download sequence
Identical sequences A0A1S3XWC2 A0A1U7WD81
XP_009775201.1.57364 XP_016444175.1.3737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]