SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1U7X7L4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7X7L4
Domain Number 1 Region: 16-262
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.14e-67
Family Capz alpha-1 subunit 0.0000409
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1U7X7L4
Sequence length 273
Comment (tr|A0A1U7X7L4|A0A1U7X7L4_NICSY) F-actin-capping protein subunit alpha isoform X2 {ECO:0000313|RefSeq:XP_009782465.1} KW=Complete proteome; Reference proteome OX=4096 OS=Nicotiana sylvestris (Wood tobacco) (South American tobacco). GN=LOC104231210 OC=Nicotianoideae; Nicotianeae; Nicotiana.
Sequence
MLEEEEDSLESETELTDEQKIEIAKWFLLNSPAGEIQYVAKDVRAILKDENVYRKAAEEA
FPSYNKSHLICLELPNRSGDVLVTSFGEVDKDEYLDPRTAQVAIVDHVKQACKEVRPARD
EELPSAFVEEYRSAMDAEIMKYVSEAYPKGICSVYCTKGKDVEDPGSDFELVVVISAARH
SPQNFCNGSWRSIWNIEFKDEIQSVEVRGKMQVGAHYFEEGNVQLDAQHECKDTTLIQDL
RRKLPVTRTLFPWHNTAQFSLTRDIEKELGIGK
Download sequence
Identical sequences A0A1S4DA18 A0A1U7X7L4
XP_009782465.1.57364 XP_016510236.1.3737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]