SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1U8A451 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U8A451
Domain Number 1 Region: 14-296
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 7.85e-82
Family Capz alpha-1 subunit 0.00000844
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1U8A451
Sequence length 307
Comment (tr|A0A1U8A451|A0A1U8A451_NELNU) F-actin-capping protein subunit alpha {ECO:0000313|RefSeq:XP_010259600.1} KW=Complete proteome; Reference proteome OX=4432 OS=Nelumbo nucifera (Sacred lotus). GN=LOC104598969 OC=Nelumbonaceae; Nelumbo.
Sequence
MSEEDSQEPESELTEEQKTEIAKWFLLNSPSGEIQYVAKDIRSVLMDENVYNMAVSEAFP
LYNKTHMISLEMPNRSGAVIVTSFGELNDNEYLDPRTAQVAKVNHIKQACTDVRPATDEE
LPSFYIEQFRCALDSELIKYVSEAYPKGACSVYCTNGKDAEPGSNFELTVVISAARHSPQ
NFCNGFWRSVWNIDFKDDTQLVELSGKIQVGAHYFEEGNVQLDANHECIDTTIFQSPEDS
ALSIANMIRHHETEYMASLEVSYSNLPDTTFKDLRRKLPVTRTLFPWNNTLQISLNREIT
KELGLGK
Download sequence
Identical sequences A0A1U8A451
XP_010259600.1.60036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]