SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1U8DMW6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U8DMW6
Domain Number 1 Region: 1-254
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.45e-94
Family Capz beta-1 subunit 0.000000000322
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1U8DMW6
Sequence length 265
Comment (tr|A0A1U8DMW6|A0A1U8DMW6_ALLSI) F-actin-capping protein subunit beta isoform X1 {ECO:0000313|RefSeq:XP_014379069.1} KW=Complete proteome; Reference proteome OX=38654 OS=Alligator sinensis (Chinese alligator). GN=CAPZB OC=Alligator.
Sequence
MRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYR
SPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVI
LIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGS
LTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSIDAIPDN
QKYKQLQRELSQVLTQRQIYIQPDN
Download sequence
Identical sequences A0A1U8DMW6
XP_008501900.1.100939 XP_008925534.1.96775 XP_009461666.1.38621 XP_009701102.1.71050 XP_009813453.1.37116 XP_009947020.1.99599 XP_009990926.1.11325 XP_010082939.1.40768 XP_010127242.1.88979 XP_010139586.1.100080 XP_010164721.1.30499 XP_010295720.1.48707 XP_010298316.1.13389 XP_014379069.1.24877 XP_015503888.1.82291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]