SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U8EIJ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U8EIJ4
Domain Number 1 Region: 169-222
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.0000785
Family VPS37 C-terminal domain-like 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1U8EIJ4
Sequence length 235
Comment (tr|A0A1U8EIJ4|A0A1U8EIJ4_CAPAN) vacuolar protein-sorting-associated protein 37 homolog 1 isoform X4 {ECO:0000313|RefSeq:XP_016543140.1} KW=Complete proteome OX=4072 OS=Capsicum annuum (Bell pepper). GN=LOC107843386 OC=Capsiceae; Capsicum.
Sequence
MFKSWRAKEQQAQSSSQEANNASWHSQYSPSVISTPSSSRPATPSSSSSSSFNAQSPTNR
PSSVSHDSPAETAGIIAALRNKSVNELKKLVTGKDVYHNFLISLEAVKTQDSVRDELWNE
TLLLVRENLEKEPWIMELRNQCRIICTTELAAAQEKMHELERRKEELLKLYSPVSLLHQL
QDAMKKTEEESEALLGQLLDREIDLTTFVQKSKKLGCSYHKRALTHLAAKAYLAA
Download sequence
Identical sequences A0A1U8EIJ4
XP_016543140.1.72714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]