SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1U8PT85 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U8PT85
Domain Number 1 Region: 9-293
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.44e-81
Family Capz alpha-1 subunit 0.00000944
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1U8PT85
Sequence length 304
Comment (tr|A0A1U8PT85|A0A1U8PT85_GOSHI) F-actin-capping protein subunit alpha-like isoform X1 {ECO:0000313|RefSeq:XP_016753578.1} KW=Complete proteome; Reference proteome OX=3635 OS=Gossypium hirsutum (Upland cotton) (Gossypium mexicanum). GN=LOC107961912 OC=Gossypium.
Sequence
MAEEEETELSDDQKKGIAKWFLVNAPAGEIQYVSRDLKLVLNDDDVYNEAASEAFPVYNK
CHLISLKMPGGFGDVLVTSYGELQDNEYLDPKTAQVAIVDHVKQACTKVRPATDEELPSA
YVEEYRCALEAEILKYVAEAYPKGSCSVYCTNGKDVEEPGSDFDLVVVIAAARLSPQNFC
NGSWRTIWNIEFKDDIQKLELNGKLQVGAHYFEEGNVQLDTKHECRDSTMFQSPDDTAIS
VANLIRRHETAYMASLEESYFKLSDNTFKDLRRKLPITRTLFPWRSTRQFSLKREISEEL
GIGK
Download sequence
Identical sequences A0A1U8PT85
XP_016753578.1.88148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]