SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U9Y0Z5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U9Y0Z5
Domain Number 1 Region: 1-191
Classification Level Classification E-value
Superfamily BB2672-like 1.57e-70
Family BB2672-like 0.0000275
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1U9Y0Z5
Sequence length 196
Comment (tr|A0A1U9Y0Z5|A0A1U9Y0Z5_9PSED) Peptide synthetase {ECO:0000313|EMBL:AQZ34712.1} KW=Complete proteome OX=1898684 OS=Pseudomonas sp. LPH1. GN=BHQ29_16500 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MSFEIRKIVSYIEETLIEGGKATDKPVTMVGLAVVIKNPWLGRGFVEDLKPEIKANCSEL
GAMMVERLTAAIGGAANIEAYGKAAVVGADGEIEHASAVIHTLRFGNHYRQAVNAKSYLS
FTNKRGGPGTSIQIPMMHKDDEGLRSHYITLEMQIEDAPRADEIVVVLGAANGGRLHPRI
GNRYIDLEELAAEQAQ
Download sequence
Identical sequences A0A1U9Y0Z5
WP_079784404.1.20494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]