SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U9YFM7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U9YFM7
Domain Number 1 Region: 88-149
Classification Level Classification E-value
Superfamily E6 C-terminal domain-like 6.28e-19
Family E6 C-terminal domain-like 0.0000272
Further Details:      
 
Domain Number 2 Region: 15-75
Classification Level Classification E-value
Superfamily E6 C-terminal domain-like 0.00000000000000405
Family E6 C-terminal domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1U9YFM7
Sequence length 158
Comment (tr|A0A1U9YFM7|A0A1U9YFM7_9PAPI) Protein E6 {ECO:0000256|RuleBase:RU363123, ECO:0000256|SAAS:SAAS01013181} OX=10566 OS=Human papillomavirus. GN=E6 OC=unclassified Papillomaviridae.
Sequence
MHQKRTAMFQDPQERPRKLPQLCTELQTTIPDIILECVYCKQQLLRREVYDFAFRDLCIV
YRDGNPYAVCDKCLKFPPNLSEYRHYCYSSYGTPLEQQYNPPLCDLLIRCINCQKPLCPE
EKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL
Download sequence
Identical sequences A0A1U9YFM7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]