SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U9YSG6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U9YSG6
Domain Number 1 Region: 79-147
Classification Level Classification E-value
Superfamily Cyanase C-terminal domain 1.83e-30
Family Cyanase C-terminal domain 0.0001
Further Details:      
 
Domain Number 2 Region: 2-75
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 3e-16
Family Cyanase N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1U9YSG6
Sequence length 147
Comment (tr|A0A1U9YSG6|A0A1U9YSG6_9BACL) Cyanate lyase {ECO:0000256|HAMAP-Rule:MF_00535} KW=Complete proteome OX=1477 OS=Paenibacillus larvae subsp. pulvifaciens. GN=B5S25_18710 OC=Paenibacillus.
Sequence
MERELAGKIIVEAKRKLGLKWADIAKVIDRSEAWTASALLGQATLSNEEAEQVASLLELD
QEVAECLTEVPYRGTTIQMPPTDPLLYRFYEMLLVYGPGMKEIIHEKFGDGIMSAIDFEM
DIKRVPDPKGDRVLMMLNGKFLPYKKF
Download sequence
Identical sequences A0A1U9YSG6
WP_079940634.1.53090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]