SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1V0J565 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V0J565
Domain Number 1 Region: 36-203,266-285
Classification Level Classification E-value
Superfamily Cytochrome f, large domain 3.14e-96
Family Cytochrome f, large domain 0.0000000129
Further Details:      
 
Domain Number 2 Region: 203-265
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 3.01e-21
Family Cytochrome f, small domain 0.0000601
Further Details:      
 
Domain Number 3 Region: 282-320
Classification Level Classification E-value
Superfamily Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor 0.00000000000000105
Family Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1V0J565
Sequence length 320
Comment (tr|A0A1V0J565|A0A1V0J565_9ROSA) Cytochrome f {ECO:0000256|HAMAP-Rule:MF_00610} OX=356594 OS=Mespilus canescens. GN=petA OC=Mespilus.
Sequence
MQTKNTFSWIKKEITRSISVSLMIYILTQAPLSNAYPIFAQQGYENPREATGRIVCANCH
LANKPVDIEVPQAVLPDTVFEAVVRIPYDLQLKQVLANGKKGALNVGAVLILPEGFELAP
PDRISPEIKEKIGNLSFQSYRPTKKNILVIGPVPGQKYSEITFPILSPDPATKKDVHFLK
YPIYVGGNRGRGQIYPDGSKSNNNVYNATAAGIVSKIIRKEKGGYEITIADASDGRQVVD
IIPPGPELLVSEGESIKLDQPLTSNPNVGGFGQGDAEIVLQDPLRVQGLLLFLASVILAQ
IFLVLKKKQFEKVQLSEMNF
Download sequence
Identical sequences A0A1C8YB96 A0A1Q1AMH3 A0A1S5R8F1 A0A1S5R8Q4 A0A1S6KL46 A0A1S6KLC7 A0A1S6KLL5 A0A1S6KLU8 A0A1V0IGZ3 A0A1V0III8 A0A1V0IKJ0 A0A1V0IM26 A0A1V0IN65 A0A1V0INH3 A0A1V0INM5 A0A1V0IRZ9 A0A1V0ISC8 A0A1V0ISL9 A0A1V0IUJ4 A0A1V0IY45 A0A1V0IZ08 A0A1V0J1V3 A0A1V0J2H7 A0A1V0J565 A0A1V0J6E9 A0A219QYG7 A0A223A9S6 A0A223FXT8 A0A223FY04 A0A223FYE8 A0A2D3E2R0 A0A2H4V2Y8 G2I906 V6BPK1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]